PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G041900.1
Common NamePOPTR_0008s04150g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 1717aa    MW: 188465 Da    PI: 5.9525
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G041900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding231.8e-07801842346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +WT +E e++ +  + +G++ +++Ia+ +  +++  +c+++++k
  Potri.008G041900.1 801 PWTSDEKEIFMHKLATFGKD-FRKIAAFLD-HKSTADCVEFYYK 842
                         8*****************99.*********.***********98 PP

2Myb_DNA-binding29.61.6e-0910131053345
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                           WT eE   +++av  +G++ ++ I++ +  +Rt+ qck ++ 
  Potri.008G041900.1 1013 DWTDEEKSMFIQAVSSYGKD-FAMISHFVR-TRTRDQCKVFFS 1053
                          5*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.07E-13785845IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-4793843IPR009057Homeodomain-like
PROSITE profilePS5129315.067797848IPR017884SANT domain
SMARTSM007176.0E-7798846IPR001005SANT/Myb domain
PROSITE profilePS5129311.96310091060IPR017884SANT domain
SMARTSM007177.5E-910101058IPR001005SANT/Myb domain
PfamPF159638.1E-810101054No hitNo description
SuperFamilySSF466893.35E-1110111060IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-610131054IPR009057Homeodomain-like
CDDcd001672.01E-710141052No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1717 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHE RSETTSSSFG GGSTSRWKDF SYSSSSHYGS SRDFNRWGPH  60
DFRRPPGHGK QGGWHMLAEE SGHLYAPYRS SDKMLEDENC RPFLRGDGRY VRNNRGYFSQ  120
RDWRGGHSWE MSNGSSNMPV RQHDVSNDHM SVDEMLMFPP SQPAHSDFVD SWDQHQLKDQ  180
QDNNKMGGVN GLGTGQRGDR ENSLDWKPLK WTRSGSLSSR GSGLSHSSSS KSLGGADSNE  240
GKAELQPKNA TPVHSLSGDV AACVTSAALS EEISSRKKAR LGWGEGLAKY EKKKVEGPET  300
SDNKDGAVVS ANNVESIHYQ TSNLAEKSHG VMGFSDCASP ATPSSVACSS SPGLEEKTFV  360
KSTNADNVVS NSCGSPSVGS QSQIEGLCFN LEKMDVSSVA NLGSSLSELL QSDDPSSVDS  420
SFVRSTAMNK LLAWKGDISK SLELTESEID SLENELKSMR FESGNRCPCP AASSPRPFDS  480
DAKPCNVQGV ASNSVPRPSP LQVASCGDGI VEKVSFCNGE LEEAHADVKE DDIDSPGTAT  540
SKLVEPVFLA RADSSTVTVK DDFDAIQSAR MNLKGVVPCA DEEVTGIFTC KEDLPSGDVI  600
SDTYGEDNLC NLILASNKQS ASRASEVFNK LLPSEQCRFD FSGVINGSSW QSDALVVENF  660
AMRKRLLRFK ERAVTLKFKA FHHLWKEDMR LLSIRKHRAK SHKKCEQSLR TTQSGFQKHR  720
SSIRARFSSP AGNLNLVPTT EILNFTSKLL ADSQLKLYRN ALKMPALILD KKEKIVSRFI  780
SSNGLVEDPC AVEKERAMIN PWTSDEKEIF MHKLATFGKD FRKIAAFLDH KSTADCVEFY  840
YKNHKSDCFE KTKKSKQTKS STNYLVASST KWNRELNAAS LDIFGAVMAA GADHAMNSRR  900
LCSSRIFSSG YRNSKITEGC DDGILEGSSI LDVLGSERET VAADVLAGIC GSMSSEAMSS  960
CITTSVDLVE GYRERKCQKV DSVAKPPLTS DVTRNFDEET CSDESCEEMD PTDWTDEEKS  1020
MFIQAVSSYG KDFAMISHFV RTRTRDQCKV FFSKARKCLG LDLMHPGHRN FGTPVSDVGN  1080
GGGSDTEDAC AIETGSAISS DKLDSKIDED LPPSVMNTEH NESDAEERIR LHSDLDGTED  1140
NNASGILDHN DSKIVDKMVS DPAEAGKRAD LALVVDSKVL NSVNQLESLQ AQKVLIVSIN  1200
AESERDQAAD KTVSVAEAGP VVGTVDASTS NANTAVELKA VAEVSNDVTG QELLLPEKSL  1260
CSSSGLMQDS TSNASHHRVN MDSCSDISRC SENIHQVSVH LESVEKPPVI SLPQENDLSI  1320
MNSVVQDSVV IQYEKKHEQL QECRDEQGKT SFCRDDYFQH LSGHPLMSQN DSSQILRGYP  1380
LQIPTKKEMN GDNYARPLSE ARSFPNSEKN VTSEKNVTSQ FEAEDCYLQK CSGSKSQHSV  1440
SELPFLSQRF EHGSDCPRDH SRRSSDMEKP CRNGDVKLFG KILSNPLQKQ NSIAHENGEK  1500
EAPHLKPAGK SATFKLTGHH PTEGNMAFLK CDRNNQLGPE NFPLSHGFWD ENRTQTGLPD  1560
SAALLAKYPA AFSNYPVPSS KMPQQTLQSV VKSNECNQSG LSVFPSRDVS GTNGVVDYQL  1620
YRSHDSTGVQ PFAVDMKQRE DIFVEMQRLN GQQARGMVGM NVVEKGAILV GGPCTGVSDP  1680
VVAIKRHYAK TDQYGGQNGT VFREEESWRG KGDLGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C6e-14759850494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D6e-14759850494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.118420.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311103.20.0myb family transcription factor family protein
TrEMBLB9HLN10.0B9HLN1_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0008s04150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein